VIP 10vials

Select variant

Research Applications

• Ingredient: VIP (28 aa amidated neuropeptide)
• Ligand for VPAC1/VPAC2 receptor research
• Studied in neuroimmune and smooth-muscle signaling models
• Single-peptide lyophilizate for laboratory assays

Description

Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) of the secretin/glucagon family. Research vials contain synthetic VIP lyophilizate for VPAC1/VPAC2 receptor and neuroimmune signaling work. Composition is the amidated VIP sequence without blend partners. For research use only. Not for human consumption.