No image
LL37 10vials
Research Peptides
$147.60
Select variant
Research Applications
- Ingredient: LL-37 (human cathelicidin AMP)
- Cationic antimicrobial peptide for innate-immunity assays
- Studied in host-defense and epithelial research
- 37-aa peptide lyophilizate
Description
LL-37 is the 37-amino-acid human cathelicidin antimicrobial peptide ([LL-37, 37 aa]) cleaved from hCAP18. Composition is synthetic LL-37 for innate immunity, membrane, and wound-microbiome research. For research use only. Not for human consumption.
Opens the VeriLab shop cart with this product. Sign in is required to place an order.